PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C017025P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Nin-like
Protein Properties Length: 884aa    MW: 98136.7 Da    PI: 6.9045
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C017025P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.75.4e-29565614352
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     k+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GIkRWP+Rkik++
  MELO3C017025P1 565 KTITLQVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIKRWPSRKIKKV 614
                     89**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.53553634IPR003035RWP-RK domain
PfamPF020422.6E-25566614IPR003035RWP-RK domain
SMARTSM006668.6E-24786869IPR000270PB1 domain
SuperFamilySSF542777.2E-20786869No hitNo description
PROSITE profilePS5174524.528786869IPR000270PB1 domain
PfamPF005642.8E-17788868IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2403.2E-22788865No hitNo description
CDDcd064074.36E-37788867No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 884 aa     Download sequence    Send to blast
MDDGMLSPAT MLDAPAETAM DLDYMDGLFL DGCWLETADG TEFLHTSPSS FGVNLDPLIG  60
WPATDMNGDF NMTQISRSNQ EEENNGFEGS EMCRRLWIGP GEHLGSPTSV MERLIRAVGY  120
IKDFVRDKDV LVQVWVPINR GGRNVLITND LPFSQNSSCT RLTKYRDVSV TYEFTADEDS  180
KKALGLPGRV FSRKVPEWTP DVRFFRSDEY PRVNHAHEHD VRGTVALPIF EQGSKNCLGV  240
IEVVMVTQQV KYGSELENVC KALEAVKLRS SDVIGHPNKK VFNRSNEAVL LEIQNTLKTA  300
CETHGLPLAQ TWASCVQQSR GGCRHSDENY SCCVSTVDRA CFVADQRIQE FHEACSEHHL  360
LKGEGIVGMA FKSNEPCFSS DITSFCNTEY PLSHHAKLFG LHAAVAIRLR CIYISKTDFV  420
LEFFLPVNCR DPEEQRVLLT SLSTIIQRSC RSLRLVTDKE CREENMQQSC RSLHLVTDVK  480
LGEESQFPFG EAGLGANGRS AMQDMSKGGK PSEVLSSSGY QHRGFNYDLN GVVEDSDECT  540
TVGNGTLPDV GLGKTGEKRR TKVDKTITLQ VLRQYFAGSL KDAAKSIGVC PTTLKRICRQ  600
HGIKRWPSRK IKKVGHSLQK LQLVIDSVEG ASGAFQIGSL YSNFQELASP NLSGSGSGPP  660
FGAKMGDCLK TSNEVGMSNL QRAASKSPSS SCSQSSSSSQ CFSSRSHQNI PHWNEAGSED  720
QMGGVNPCDG ELKRVKSEVE IHVSIMEGSN VPRRSQSCKS LCKHPGAECV VHTAKESNGM  780
AEAVEVQRVK VSFGEEKIRF RVHNRWRHEE LLNEIAKRFS ISDISKFDLK YLDDESEWVL  840
LTSDTDLQEC FHVYKSSRVQ TIKLSLQVSR RHKRNFLASS GFS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818610.0LN681861.1 Cucumis melo genomic scaffold, anchoredscaffold00029.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008452962.10.0PREDICTED: protein NLP4 isoform X3
TrEMBLA0A0A0L5W80.0A0A0A0L5W8_CUCSA; Uncharacterized protein
STRINGSolyc04g082480.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein